быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADARB2 Rabbit pAb (A20802)
- Описание
- Характеристики
-
Overview
Product name ADARB2 Rabbit pAb Catalog No. A20802 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-739 of human ADARB2 (NP_061172.1). Sequence SHRMEGVGQLPASYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCGGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKAGLGTWVRKPPEQQQFLLTL Gene ID Swiss Prot Synonyms RED2; ADAR3 Calculated MW 81kDa Observed MW 81kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251MG, U-87MG Cellular location cytoplasm, nucleolus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ADARB2 antibody (A20802) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-739 of human ADARB2 (NP_061172.1). Isotype IgG