быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
β1-Adrenergic Receptor Rabbit pAb (A20818)
- Описание
- Характеристики
-
Overview
Product name β1-Adrenergic Receptor Rabbit pAb Catalog No. A20818 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human β1-Adrenergic Receptor (NP_000675.1). Sequence HRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG Gene ID Swiss Prot Synonyms RHR; B1AR; FNSS2; ADRB1R; BETA1AR Calculated MW 51kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, Mouse heart, Rat heart Cellular location early endosome, neuronal dense core vesicle, plasma membrane, Schaffer collateral - CA1 synapse 
Western blot analysis of extracts of various cell lines, using β1-Adrenergic Receptor antibody (A20818) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human β1-Adrenergic Receptor (NP_000675.1). Isotype IgG