быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAMTS5 Rabbit pAb (A2836)
- Описание
- Характеристики
-
Overview
Product name ADAMTS5 Rabbit pAb Catalog No. A2836 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and functions as an aggrecanase that cleaves aggrecan, a major proteoglycan of cartilage, and may mediate cartilage destruction in osteoarthritis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ADAMTS5 (NP_008969.2). Sequence RNNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR Gene ID Swiss Prot Synonyms ADAMTS5; ADAM-TS 11; ADAM-TS 5; ADAM-TS5; ADAMTS-11; ADAMTS-5; ADAMTS11; ADMP-2; ADAM-TS11 Calculated MW 101kDa Observed MW 73kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-12 Cellular location Secreted, extracellular matrix, extracellular space Customer validation WB(Homo sapiens, Rattus norvegicus, Mus musculus)
IF(Sus scrofa)
IHC(Rattus norvegicus)
IHC(Homo sapiens, Rattus norvegicus, Mus musculus)
ELISA(Rattus norvegicus)
Western blot analysis of PC-12, using ADAMTS5 Rabbit pAb (A2836) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ADAMTS5 (NP_008969.2). Isotype IgG