- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name ADAM17 Rabbit pAb Catalog No. A0821 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. The encoded protease functions in the ectodomain shedding of tumor necrosis factor-alpha, in which soluble tumor necrosis factor-alpha is released from the membrane-bound precursor. This protease also functions in the processing of numerous other substrates, including cell adhesion proteins, cytokine and growth factor receptors and epidermal growth factor (EGF) receptor ligands, and plays a prominent role in the activation of the Notch signaling pathway. Elevated expression of this gene has been observed in specific cell types derived from psoriasis, rheumatoid arthritis, multiple sclerosis and Crohn's disease patients, suggesting that the encoded protein may play a role in autoimmune disease. Additionally, this protease may play a role in viral infection through its cleavage of ACE2, the cellular receptor for SARS-CoV and SARS-CoV-2.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human ADAM17 (NP_003174.3). Sequence KQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Gene ID Swiss Prot Synonyms CSVP; TACE; NISBD; ADAM18; CD156B; NISBD1 Calculated MW 93kDa Observed MW 120kDa/100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:100 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HepG2, Jurkat, Mouse heart, Mouse kidney Cellular location Membrane, Single-pass type I membrane protein Customer validation IHC(Homo sapiens,Mus musculus)
WB(Mus musculus, Homo sapiens)
IF(Mus musculus)
IP(Homo sapiens)
IP(Homo sapiens)

Western blot analysis of extracts of various cell lines, using ADAM17 antibody (A0821) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded rat heart using ADAM17 antibody (A0821) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunofluorescence analysis of HeLa cells using ADAM17 Rabbit pAb (A0821) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using ADAM17 Rabbit pAb (A0821) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using ADAM17 Rabbit pAb (A0821) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human ADAM17 (NP_003174.3). Isotype IgG







