быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADIPOR2 Rabbit pAb (A12777)
- Описание
- Характеристики
-
Overview
Product name ADIPOR2 Rabbit pAb Catalog No. A12777 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2). Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG Gene ID Swiss Prot Synonyms PAQR2; ACDCR2 Calculated MW 44kDa Observed MW 44kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse heart, Rat skeletal muscle Cellular location Cell membrane, Multi-pass membrane protein Customer validation WB(Homo sapiens,Mus musculus, Sus scrofa)
Western blot analysis of extracts of Mouse heart, using ADIPOR2 antibody (A12777) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Rat skeletal muscle, using ADIPOR2 antibody (A12777) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2). Isotype IgG