быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNRF3 Rabbit pAb (A16026)
- Описание
- Характеристики
-
Overview
Product name ZNRF3 Rabbit pAb Catalog No. A16026 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables frizzled binding activity and ubiquitin-protein transferase activity. Involved in cellular protein metabolic process and negative regulation of Wnt signaling pathway. Is integral component of plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZNRF3 (NP_001193927.1). Sequence PGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRG Gene ID Swiss Prot Synonyms RNF203; BK747E2.3 Calculated MW 101kDa Observed MW 101kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse testis Cellular location plasma membrane Customer validation WB(Homo sapiens)
IHC(Homo sapiens)
Western blot analysis of extracts of Mouse testis, using ZNRF3 antibody (A16026) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human liver using ZNRF3 antibody (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using ZNRF3 antibody (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using ZNRF3 antibody (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZNRF3 (NP_001193927.1). Isotype IgG