быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABI5 Rabbit pAb (A21249)
- Описание
- Характеристики
-
Overview
Product name ABI5 Rabbit pAb Catalog No. A21249 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Encodes a member of the basic leucine zipper transcription factor family, involved in ABA signalling during seed maturation and germination. The Arabidopsis abscisic acid (ABA)-insensitive abi5 mutants have pleiotropic defects in ABA response, including decreased sensitivity to ABA inhibition of germination and altered expression of some ABA-regulated genes. Comparison of seed and ABA-inducible vegetative gene expression in wild-type and abi5-1 plants indicates that ABI5 regulates a subset of late embryogenesis-abundant genes during both developmental stages.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana ABI5 (NP_001324735.1). Sequence EFQHALCENGKNFGSMNMDEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSGGSRGNEDANNKRGIANESSLPRQGSLTLPA Gene ID Swiss Prot Synonyms ABA INSENSITIVE 5; AtABI5; F2H17.12; F2H17_12; GIA1; GROWTH-INSENSITIVITY TO ABA 1 Calculated MW 47kDa Observed MW 50kDa Applications
Reactivity Arabidopsis thaliana Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples Cellular location nucleus Customer validation WB(Oryza sativa)
Western blot analysis of extracts of various cell lines, using ABI5 antibody (A21249) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Резуховидка Таля(Arabidopsis thaliana) Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana ABI5 (NP_001324735.1). Isotype IgG