![[KD Validated] NDUFS5 Rabbit pAb (A21504)](/upload/resize_cache/iblock/a54/340_340_140cd750bba9870f18aada2478b24840a/eiiucp5epbl49fcz1e9eqxyj7jxn03k1.jpg "[KD Validated] NDUFS5 Rabbit pAb (A21504)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] NDUFS5 Rabbit pAb (A21504)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] NDUFS5 Rabbit pAb Catalog No. A21504 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1). Sequence MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Gene ID Swiss Prot Synonyms CI15K; CI-15k Calculated MW 13kDa Observed MW 13kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Peripheral membrane protein 
Western blot analysis of extracts from wild type(WT) and NDUFS5 knockdown (KD) 293T cells, using NDUFS5 antibody (A21504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of L929 cells using NDUFS5 Rabbit pAb (A21504) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1). Isotype IgG