быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADIPOR1 Rabbit pAb (A21533)
- Описание
- Характеристики
-
Overview
Product name ADIPOR1 Rabbit pAb Catalog No. A21533 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human ADIPOR1 (NP_057083.2). Sequence MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG Gene ID Swiss Prot Synonyms CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A Calculated MW 43kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using ADIPOR1 antibody (A21533) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human ADIPOR1 (NP_057083.2). Isotype IgG