быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACC1 Rabbit pAb (A21752)
- Описание
- Характеристики
-
Overview
Product name ACC1 Rabbit pAb Catalog No. A21752 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1190-1340 of human ACC1 (NP_942133.1). Sequence NRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQV Gene ID Swiss Prot Synonyms ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha Calculated MW 266kDa Observed MW 265kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T Cellular location Cytoplasm 
Western blot analysis of extracts from 293T, using ACC1 Rabbit pAb (A21752) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using ACC1 Rabbit pAb (A21752) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1190-1340 of human ACC1 (NP_942133.1). Isotype IgG







