![[KD Validated] GPLD1 Rabbit pAb (A21781)](/upload/resize_cache/iblock/6ff/340_340_140cd750bba9870f18aada2478b24840a/4z23roq1yuu5oqcyjwfkicabnmf04fpt.jpg "[KD Validated] GPLD1 Rabbit pAb (A21781)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] GPLD1 Rabbit pAb (A21781)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] GPLD1 Rabbit pAb Catalog No. A21781 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2). Sequence CGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSA Gene ID Swiss Prot Synonyms PLD; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1 Calculated MW 92kDa Observed MW 92kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Daudi Cellular location Secreted 
Western blot analysis of Daudi, using GPLD1 Rabbit pAb antibody (A21781) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type(WT) and GPLD1 Rabbit pAb knockdown (KD) 293T cells, using GPLD1 Rabbit pAb antibody (A21781) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2). Isotype IgG