быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Adiponectin Rabbit pAb (A2543)
- Описание
- Характеристики
-
Overview
Product name Adiponectin Rabbit pAb Catalog No. A2543 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-104 of human Adiponectin (NP_004788.1). Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEP Gene ID Swiss Prot Synonyms ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1 Calculated MW 26kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse kidney, Rat heart Cellular location Secreted Customer validation WB(Mesocricetus auratus, Mus musculus, Sus scrofa)
Western blot analysis of extracts of various cell lines, using Adiponectin antibody (A2543) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using Adiponectin antibody (A2543) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-104 of human Adiponectin (NP_004788.1). Isotype IgG