[KD Validated] RAB27A Rabbit pAb (A1934)

быстрая доставка ~4 недели

Размер

100 μL
20 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KD Validated] RAB27A Rabbit pAb
Catalog No.	A1934
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human RAB27A (NP_899057.1).
Sequence	MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Gene ID
Swiss Prot
Synonyms	GS2; RAM; RAB27; HsT18676
Calculated MW	25kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IF/ICC
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG(KD)
Cellular location	Late endosome, Lipid-anchor, Lysosome, Melanosome, Membrane
Customer validation	WB(Homo sapiens,Mus musculus) IF(Homo sapiens,Mus musculus)

Western blot analysis of extracts from wild type(WT) and RAB27A knockdown (KD) U-87MG(KD) cells, using RAB27A antibody (A1934) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunofluorescence analysis of HepG2 cells using [KD Validated] RAB27A Rabbit pAb (A1934) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human RAB27A (NP_899057.1).
Isotype	IgG