![[KD Validated] DIAPH1 Rabbit pAb (A18081)](/upload/resize_cache/iblock/a43/340_340_140cd750bba9870f18aada2478b24840a/c2ytig1se8n5mzt2jx1rd1f1n6fl5ykt.jpg "[KD Validated] DIAPH1 Rabbit pAb (A18081)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KD Validated] DIAPH1 Rabbit pAb (A18081)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] DIAPH1 Rabbit pAb Catalog No. A18081 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1149-1263 of human DIAPH1 (NP_001073280.1). Sequence TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS Gene ID Swiss Prot Synonyms DIA1; DRF1; DFNA1; LFHL1; SCBMS; hDIA1; mDia1 Calculated MW 141kDa Observed MW 150kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Cell membrane, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane 
Western blot analysis of extracts from wild type(WT) and DIAPH1 knockdown (KD) 293T cells, using DIAPH1 Rabbit pAb (A18081) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1149-1263 of human DIAPH1 (NP_001073280.1). Isotype IgG