![[KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)](/upload/resize_cache/iblock/bdf/340_340_140cd750bba9870f18aada2478b24840a/uulfnuk7osa3r53aai4sb4rnyqnxro2h.jpg "[KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] NDUFA13/GRIM19 Rabbit pAb Catalog No. A5412 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (NP_057049.5). Sequence MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT Gene ID Swiss Prot Synonyms B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28 Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, PC-3 Cellular location Matrix side, Mitochondrion inner membrane, Nucleus, Single-pass membrane protein Customer validation WB(C2C12, Homo sapiens)
Western blot analysis of various lysates, using NDUFA13/GRIM19 Rabbit pAb antibody (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of extracts from wild type(WT) and NDUFA13/GRIM19 Rabbit pAb knockdown (KD) 293T cells, using NDUFA13/GRIM19 Rabbit pAb antibody (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (NP_057049.5). Isotype IgG