быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCC3 Rabbit pAb (A9849)
- Описание
- Характеристики
-
Overview
Product name ABCC3 Rabbit pAb Catalog No. A9849 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human ABCC3 (NP_003777.2). Sequence SEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAA Gene ID Swiss Prot Synonyms MLP2; MRP3; ABC31; MOAT-D; cMOAT2; EST90757 Calculated MW 169kDa Observed MW 169kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, SW620 Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using ABCC3 antibody (A9849) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human ABCC3 (NP_003777.2). Isotype IgG