быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCB4 Rabbit pAb (A9835)
- Описание
- Характеристики
-
Overview
Product name ABCB4 Rabbit pAb Catalog No. A9835 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1). Sequence MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILE Gene ID Swiss Prot Synonyms GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3 Calculated MW 142kDa Observed MW 144kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain Cellular location Apical cell membrane, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane raft, Multi-pass membrane protein, clathrin-coated vesicle Customer validation WB(Mus musculus)
Western blot analysis of extracts of mouse brain, using ABCB4 antibody (A9835) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1). Isotype IgG