быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ACKR3 Rabbit pAb (A12712)
- Описание
- Характеристики
-
Overview
Product name ACKR3 Rabbit pAb Catalog No. A12712 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACKR3 (NP_064707.1). Sequence TNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSS Gene ID Swiss Prot Synonyms RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159 Calculated MW 41kDa Observed MW 44kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 4T1, Mouse brain, Mouse lung Cellular location Cell membrane, Cytoplasm, Early endosome, Multi-pass membrane protein, Recycling endosome, perinuclear region 
Western blot analysis of extracts of various cell lines, using ACKR3 Rabbit pAb (A12712) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of C6 cells using ACKR3 Rabbit pAb (A12712) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using ACKR3 Rabbit pAb (A12712) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using ACKR3 Rabbit pAb (A12712) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACKR3 (NP_064707.1). Isotype IgG