быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADPRM Rabbit pAb (A12883)
- Описание
- Характеристики
-
Overview
Product name ADPRM Rabbit pAb Catalog No. A12883 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable 2', 3'-cyclic-nucleotide 2'-phosphodiesterase activity; manganese ion binding activity; and pyrophosphatase activity. Predicted to be located in cytosol.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 203-342 of human ADPRM (NP_064618.3). Sequence SEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC Gene ID Swiss Prot Synonyms MDS006; C17orf48; NBLA03831 Calculated MW 40kDa Observed MW 39kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Mouse spleen, Rat brain, Rat lung Cellular location cytosol 
Western blot analysis of extracts of various cell lines, using ADPRM antibody (A12883) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 203-342 of human ADPRM (NP_064618.3). Isotype IgG