быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ACTRT3 Rabbit pAb (A13198)
- Описание
- Характеристики
-
Overview
Product name ACTRT3 Rabbit pAb Catalog No. A13198 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to be located in male germ cell nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ACTRT3 (NP_115876.3). Sequence MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPA Gene ID Swiss Prot Synonyms ARPM1; ARP-T3 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, HT-29, 293T, Mouse testis, Mouse brain, Mouse kidney, Rat testis, Rat brain, Rat kidney Cellular location Cytoplasm, Nucleus, cytoskeleton 
Western blot analysis of extracts of various cell lines, using ACTRT3 antibody (A13198) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ACTRT3 (NP_115876.3). Isotype IgG