быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADCYAP1R1 Rabbit pAb (A3120)
- Описание
- Характеристики
-
Overview
Product name ADCYAP1R1 Rabbit pAb Catalog No. A3120 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2). Sequence CIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE Gene ID Swiss Prot Synonyms PAC1; PAC1R; PACAPR; PACAPRI Calculated MW 53kDa Observed MW 53kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-87MG, Mouse heart Cellular location Cell membrane, Multi-pass membrane protein Customer validation WB(Homo sapiens, Rattus norvegicus)
Western blot analysis of extracts of Mouse heart cells, using ADCYAP1R1 antibody (A3120) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts of U-87MG cells, using ADCYAP1R1 antibody (A3120) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of C6 cells using ADCYAP1R1 Rabbit pAb (A3120) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using ADCYAP1R1 Rabbit pAb (A3120) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of SH-SY5Y cells using ADCYAP1R1 Rabbit pAb (A3120) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2). Isotype IgG