быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
14-3-3 gamma Rabbit pAb (A3043)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 gamma Rabbit pAb Catalog No. A3043 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (NP_036611.2). Sequence VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA Gene ID Swiss Prot Synonyms DEE56; EIEE56; PPP1R170; 14-3-3GAMMA Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples U-251MG, K-562, HeLa, Mouse brain, Mouse heart Cellular location Cytoplasm 
Immunohistochemistry analysis of paraffin-embedded Human colon using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Rat spleen using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (NP_036611.2). Isotype IgG