быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF75A Rabbit pAb (A17010)
- Описание
- Характеристики
-
Overview
Product name ZNF75A Rabbit pAb Catalog No. A17010 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-296 of human ZNF75A (NP_694573.1). Sequence WSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL Gene ID Swiss Prot Synonyms ZNF75A Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549 Cellular location nucleus 
Western blot analysis of extracts of A-549 cells, using ZNF75A Rabbit pAb (A17010) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-296 of human ZNF75A (NP_694573.1). Isotype IgG