быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ACOX3 Rabbit pAb (A17020)
- Описание
- Характеристики
-
Overview
Product name ACOX3 Rabbit pAb Catalog No. A17020 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137). Sequence TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP Gene ID Swiss Prot Synonyms ACOX3 Calculated MW 78kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Cellular location cytosol, peroxisomal matrix, peroxisome Customer validation WB(Mus musculus)
Immunofluorescence analysis of C6 cells using ACOX3 antibody (A17020) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody (A17020) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137). Isotype IgG