быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADORA2B Rabbit pAb (A1953)
- Описание
- Характеристики
-
Overview
Product name ADORA2B Rabbit pAb Catalog No. A1953 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1). Sequence AVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV Gene ID Swiss Prot Synonyms ADORA2 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A-431, 293T Cellular location Cell membrane, Multi-pass membrane protein Customer validation WB(Mus musculus,Homo sapiens)
IF(Mus musculus,Homo sapiens)
Western blot analysis of various lysates, using ADORA2B antibody (A1953) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunofluorescence analysis of C6 cells using ADORA2B Rabbit pAb (A1953) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1). Isotype IgG