быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
δ-Catenin/p120 Catenin Rabbit pAb (A1641)
- Описание
- Характеристики
-
Overview
Product name δ-Catenin/p120 Catenin Rabbit pAb Catalog No. A1641 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-968 of human δ-Catenin/p120 Catenin (NP_001078927.1). Sequence QVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI Gene ID Swiss Prot Synonyms CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN) Calculated MW 108kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29, NIH/3T3, C6 Cellular location Cell membrane, Cytoplasm, Nucleus 
Immunohistochemistry analysis of paraffin-embedded human liver cancer using δ-Catenin/p120 Catenin Rabbit pAb (A1641) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human prostate cancer using δ-Catenin/p120 Catenin Rabbit pAb (A1641) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human urothelial carcinoma using δ-Catenin/p120 Catenin Rabbit pAb (A1641) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse colon using δ-Catenin/p120 Catenin Rabbit pAb (A1641) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat uterus using δ-Catenin/p120 Catenin Rabbit pAb (A1641) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-968 of human δ-Catenin/p120 Catenin (NP_001078927.1). Isotype IgG