быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABR Rabbit pAb (A15635)
- Описание
- Характеристики
-
Overview
Product name ABR Rabbit pAb Catalog No. A15635 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1). Sequence DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV Gene ID Swiss Prot Synonyms MDB Calculated MW 98kDa Observed MW 110kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse thymus, Rat lung, Rat spleen Cellular location axon, cytosol, dendritic spine, glutamatergic synapse, Schaffer collateral - CA1 synapse 
Western blot analysis of extracts of various cell lines, using ABR antibody (A15635) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1). Isotype IgG