быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF688 Rabbit pAb (A15568)
- Описание
- Характеристики
-
Overview
Product name ZNF688 Rabbit pAb Catalog No. A15568 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ZNF688 (NP_660314.1). Sequence QESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQ Gene ID Swiss Prot Synonyms ZNF688 Calculated MW 31kDa Observed MW 31kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse brain, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using ZNF688 antibody (A15568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ZNF688 (NP_660314.1). Isotype IgG