быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 ORF3A Rabbit pAb (A20234)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 ORF3A Rabbit pAb Catalog No. A20234 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF3a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF3a protein is thought to be a protein with ion channel activity (viroporin) that activates the NLRP3 inflammasome. ORF3a may also play a role in virus replication and pathogenesis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1). Sequence GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC Gene ID Swiss Prot Synonyms Calculated MW 31kDa Observed MW 35kDa Applications
Reactivity SARS-CoV-2 Tested applications WB Recommended dilution - WB 1:2000 - 1:6000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Customer validation WB(SARS-CoV-2, Homo sapiens, Chlorocebus aethiops)
Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF3A antibody (A20234) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV-2 Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1). Isotype IgG