быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV-2 NSP15 Rabbit pAb (A20282)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV-2 NSP15 Rabbit pAb Catalog No. A20282 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 6600-6700 of coronavirus NSP15 (YP_009724389.1). Sequence VKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGL Gene ID Swiss Prot Synonyms Calculated MW 794kDa Observed MW 42kDa Applications
Reactivity SARS-CoV-2 Tested applications WB Recommended dilution - WB 1:2000 - 1:6000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location 
Western blot analysis of extracts of normal 293T cells and 293T transfected with NSP15 Protein, using SARS-CoV-2 NSP15 antibody (A20282) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV-2 Immunogen A synthetic peptide corresponding to a sequence within amino acids 6600-6700 of coronavirus NSP15 (YP_009724389.1). Isotype IgG







