быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACAT2 Rabbit mAb (A1399)
- Описание
- Характеристики
-
Overview
Product name ACAT2 Rabbit mAb Catalog No. A1399 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2560 Background
The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACAT2 (Q9BWD1). Sequence GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPAN Gene ID Swiss Prot Synonyms ACAT2; acetyl-CoA acetyltransferase 2 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SW620, HepG2, Mouse liver, Mouse brain, Mouse kidney, Rat brain, Rat kidney Cellular location Cytoplasm Customer validation WB(Actinopterygii)
Western blot analysis of extracts of various cell lines, using ACAT2 antibody (A1399) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using ACAT2 antibody (A1399) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACAT2 (Q9BWD1). Isotype IgG