быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABL2 Rabbit mAb (A19628)
- Описание
- Характеристики
-
Overview
Product name ABL2 Rabbit mAb Catalog No. A19628 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2200 Background
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684). Sequence KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE Gene ID Swiss Prot Synonyms ARG; ABLL Calculated MW 128kDa Observed MW 128kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, U-87MG, Rat testis Cellular location Actin cytoskeleton, Cytosol 
Western blot analysis of extracts of various cell lines, using ABL2 Rabbit mAb (A19628) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684). Isotype IgG