[KD Validated] eIF4EBP1 Rabbit mAb (A23500)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KD Validated] eIF4EBP1 Rabbit mAb
Catalog No.	A23500
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56864

Background

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (NP_004086.1).
Sequence	MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN
Gene ID
Swiss Prot
Synonyms	BP-1; 4EBP1; 4E-BP1; PHAS-I
Calculated MW	13kDa
Observed MW	20kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IF/ICC
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa
Cellular location	Cytoplasm, Nuclear

Western blot analysis of extracts from wild type(WT) and knockdown (KD) HeLa cells, using eIF4EBP1 Rabbit mAb (A23500) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Confocal imaging of HeLa cells using [KD Validated] eIF4EBP1 Rabbit mAb (A23500, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (NP_004086.1).
Isotype	IgG