быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAMTS1 Rabbit mAb (A23840)
- Описание
- Характеристики
-
Overview
Product name ADAMTS1 Rabbit mAb Catalog No. A23840 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61847 Background
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function.Immunogen information
Immunogen Recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3). Sequence LGRPSEEDEELVVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPG Gene ID Swiss Prot Synonyms ADAMTS1; C3-C5; METH1; ADAM metallopeptidase with thrombospondin type 1 motif 1 Calculated MW 105kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications IF/ICC Recommended dilution - IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples Cellular location Secreted, extracellular matrix, extracellular space 
Immunofluorescence analysis of 293F cells using ADAMTS1 Rabbit mAb (A23840) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using ADAMTS1 Rabbit mAb (A23840) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using ADAMTS1 Rabbit mAb (A23840) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using ADAMTS1 Rabbit mAb (A23840) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3). Isotype IgG