быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Aconitase 2 (ACO2) Rabbit mAb (A4524)
- Описание
- Характеристики
-
Overview
Product name Aconitase 2 (ACO2) Rabbit mAb Catalog No. A4524 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1072 Background
The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Aconitase 2 (ACO2) (Q99798). Sequence MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEV Gene ID Swiss Prot Synonyms ICRD; OCA8; OPA9; ACONM; HEL-S-284 Calculated MW 85kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, Jurkat, SH-SY5Y, Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat heart Cellular location Mitochondrion Customer validation WB(Mus musculus)
Western blot analysis of various lysates, using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates, using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Aconitase 2 (ACO2) (ACO2) Rabbit mAb (A4524) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Aconitase 2 (ACO2) (Q99798). Isotype IgG