быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAM15 Rabbit mAb (A6813)
- Описание
- Характеристики
-
Overview
Product name ADAM15 Rabbit mAb Catalog No. A6813 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1419 Background
The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444). Sequence RHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS Gene ID Swiss Prot Synonyms MDC15 Calculated MW 55kDa/88kDa/89kDa/90kDa/93kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HCT 116 Cellular location Cell junction, Cell projection, Cytoplasmic vesicle, Endomembrane system, acrosome, adherens junction, cilium, flagellum, secretory vesicle Customer validation WB(Mus musculus)
Western blot analysis of extracts of HCT116 cells, using ADAM15 Rabbit mAb (A6813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded rat lung using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat rectum using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human colon carcinoma using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse large intestine using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444). Isotype IgG