быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
14-3-3 Theta Rabbit mAb (A8936)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 Theta Rabbit mAb Catalog No. A8936 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1358 Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348). Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL Gene ID Swiss Prot Synonyms 1C5; HS1; 14-3-3 Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples C6, U-251MG, Mouse testis, Mouse brain, Rat testis Cellular location Cytoplasm Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using 14-3-3 Theta Rabbit mAb (A8936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 Theta Rabbit mAb (A8936) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348). Isotype IgG