![[KD Validated] Smad2 Rabbit mAb (A19114)](/upload/resize_cache/iblock/3a1/340_340_140cd750bba9870f18aada2478b24840a/0d4r1f397bxy9puvpx37vgqh6rq6dgkb.jpg "[KD Validated] Smad2 Rabbit mAb (A19114)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KD Validated] Smad2 Rabbit mAb (A19114)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] Smad2 Rabbit mAb Catalog No. A19114 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0343 Background
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (Q15796). Sequence MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG Gene ID Swiss Prot Synonyms JV18; LDS6; CHTD8; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2 Calculated MW 52kDa Observed MW 58kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, HT-29, Jurkat, NIH/3T3, Rat lung Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus, Oryctolagus cuniculus, Rattus norvegicus, Homo sapiens)
IF(Mus musculus)
IHC(Mus musculus)
PCR(Mus musculus)
IP(Homo sapiens)
Western blot analysis of extracts from wild type (WT) and Smad2 knockdown (KD) HeLa cells, using Smad2 antibody (A19114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of various cell lines, using Smad2 antibody (A19114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Rat lung, using Smad2 antibody (A19114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of NIH-3T3 cells using [KD Validated] Smad2 Rabbit mAb (A19114) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Smad2 antibody (A19114). Western blot was performed from the immunoprecipitate using Smad2 antibody (A19114) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (Q15796). Isotype IgG