быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Антитела моноклональные кроличьи к Аквапорину-1 (AQP1) (Aquaporin-1 (AQP1) Rabbit mAb), ABclonal
- Описание
-
Overview
Product name Aquaporin-1 (AQP1) Rabbit mAb Catalog No. A4195 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 170-269 of human Aquaporin-1 (Aquaporin-1 (AQP1)) (P29972). Sequence LAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Gene ID Swiss Prot Synonyms AQP-CHIP; CHIP28; CO Calculated MW 28kDa Observed MW 26KDa Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse liver, Rat spleen, Rat kidney Cellular location Cell membrane, Multi-pass membrane protein Aquaporin-1 (AQP1) Rabbit mAb images
Western blot - Aquaporin-1 (AQP1) Rabbit mAb (A4195)
Western blot analysis of extracts of Mouse liver, using Aquaporin-1 (Aquaporin-1 (AQP1)) Rabbit mAb (A4195) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot - Aquaporin-1 (AQP1) Rabbit mAb (A4195)
Western blot analysis of extracts of various cell lines, using Aquaporin-1 (Aquaporin-1 (AQP1)) Rabbit mAb (A4195) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry - Aquaporin-1 (AQP1) Rabbit mAb (A4195)
Immunohistochemistry of paraffin-embedded rat kidney using Aquaporin-1 (Aquaporin-1 (AQP1)) Rabbit mAb (A4195) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Aquaporin-1 (AQP1) Rabbit mAb (A4195)
Immunohistochemistry of paraffin-embedded human colon carcinoma using Aquaporin-1 (Aquaporin-1 (AQP1)) Rabbit mAb (A4195) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Aquaporin-1 (AQP1) Rabbit mAb (A4195)
Immunohistochemistry of paraffin-embedded mouse kidney using Aquaporin-1 (Aquaporin-1 (AQP1)) Rabbit mAb (A4195) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols