быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Антитела поликлональные кроличьи к HIF1α (HIF1α Rabbit pAb), ABclonal
- Описание
-
Overview
Product name HIF1α Rabbit pAb Catalog No. A17906 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 670-826 of human HIF1α (NP_001521.1). Sequence NRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN Gene ID Swiss Prot Synonyms HIF1A; HIF-1-alpha; HIF-1A; HIF-1alpha; HIF1; HIF1-ALPHA; MOP1; PASD8; bHLHe78 Calculated MW 82kDa/92kDa/95kDa Observed MW 120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000 Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm, Nucleus, Nucleus speckle Customer validation WB(Homo sapiens)
HIF1α Rabbit pAb images
Western blot - HIF1α Rabbit pAb (A17906)
Western blot analysis of extracts of HeLa cells, using HIF1α antibody (A17906) at 1:1000 dilution.HeLa cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols