быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Антитела поликлональные кроличьи к гистону H2AX (Histone H2AX Rabbit pAb), ABclonal
- Описание
-
Overview
Product name Histone H2AX Rabbit pAb Catalog No. A11463 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human Histone H2AX (NP_002096.1). Sequence VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Gene ID Swiss Prot Synonyms H2A.X; H2A/X; H2AX; Histone H2AX; H2AFX; histone H2AX; Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:1000
IHC 1:50 - 1:200
IF 1:50 - 1:200
IP 1:50 - 1:100Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, MCF-7, NIH/3T3, Raji, Mouse testis, Mouse thymus, Rat thymus Cellular location Chromosome, Nucleus Customer validation IHC(Homo sapiens)
WB(Mus musculus)
IF(Gallus gallus)
Histone H2AX Rabbit pAb images
Western blot - Histone H2AX Rabbit pAb (A11463)
Western blot analysis of extracts of various cell lines, using Histone H2AX antibody (A11463) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Immunohistochemistry - Histone H2AX Rabbit pAb (A11463)
Immunohistochemistry of paraffin-embedded human liver cancer using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Histone H2AX Rabbit pAb (A11463)
Immunohistochemistry of paraffin-embedded human placenta using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Histone H2AX Rabbit pAb (A11463)
Immunohistochemistry of paraffin-embedded mouse kidney using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Histone H2AX Rabbit pAb (A11463)
Immunohistochemistry of paraffin-embedded rat liver using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence - Histone H2AX Rabbit pAb (A11463)
Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Polyclonal Antibody (A11463) at dilution of 1:400. Blue: DAPI for nuclear staining.
Immunofluorescence - Histone H2AX Rabbit pAb (A11463)
Confocal immunofluorescence analysis of U-2 OS cells using Histone H2AX Polyclonal Antibody (A11463) at dilution of 1:400. Blue: DAPI for nuclear staining.
Immunofluorescence - Histone H2AX Rabbit pAb (A11463)
Immunofluorescence analysis of U2OS cells using Histone H2AX Rabbit pAb (A11463) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation - Histone H2AX Rabbit pAb (A11463)
Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug Histone H2AX antibody (A11463). Western blot was performed from the immunoprecipitate using Histone H2AX antibody (A11463) at a dilition of 1:1000.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols