быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Поликлональные антитела кролика к IFNB1 (IFNB1 Rabbit pAb)
- Описание
-
Overview
Product name IFNB1 Rabbit pAb Catalog No. A16223 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-187 of human IFNB1 (NP_002167.1). Sequence LQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN Gene ID Swiss Prot Synonyms IFNB1; IFB; IFF; IFN-beta; IFNB Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human, Mouse Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000 Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, A-431, Mouse liver, Mouse small intestine Cellular location Secreted IFNB1 Rabbit pAb images
Western blot - IFNB1 Polyclonal Antibody (A16223)
Western blot analysis of extracts of various cell lines, using IFNB1 antibody (A16223) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols